|
Build Your Online Product Catalogs?
Product Name: |
SPECIFICATION OF MAMBALGIN 1
|
Supply Ability: |
100g |
Related proudcts |
|
Specifications |
see description |
Price Term: |
T/T |
Port of loading: |
|
Minimum Order |
1mg |
Unit Price: |
100 |
|
CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin 1 Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20℃. Storage of solutions Up to two weeks at 4℃ or three months at -20℃. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)
APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As one of peptide suppliers, we can offer kinds of peptides synthesis for sale, if you have needs, please contact us. |
Company: |
Hefei KS-V Peptide Biological Technology Co., Ltd.
|
Contact: |
KS-V Peptide .com |
Address: |
The 11th floor£¬New Energy Building£¬Institute of Advanced Technology£¬USTC£¬Hefei, Anhui, China |
Postcode: |
2018 |
Tel: |
0551-65120828 |
Fax: |
|
E-mail: |
|
|
|
|