|
|
Build Your Online Product Catalogs?
| Product Name: |
MARGATOXIN
|
| Supply Ability: |
100g |
| Related proudcts |
|
| Specifications |
see description |
| Price Term: |
T/T |
| Port of loading: |
|
| Minimum Order |
1mg |
| Unit Price: |
100 |
|
SPECIFICATION OF MARGATOXIN
CAT K1020-V
CAS NO. 145808-47-5
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20℃.
Storage of solutions Up to two weeks at 4℃ or three months at -20℃.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)
APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
As a peptide co***ny, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message. |
| Company: |
Hefei KS-V Peptide Biological Technology Co., Ltd.
|
| Contact: |
KS-V Peptide .com |
| Address: |
The 11th floor£¬New Energy Building£¬Institute of Advanced Technology£¬USTC£¬Hefei, Anhui, China |
| Postcode: |
2018 |
| Tel: |
0551-65120828 |
| Fax: |
|
| E-mail: |
|
|
|
|
Home
