86exporter.com Home       Products Catalog      Suppliers Catalog      Log In        Sign up
      About Us
      Profile
      Products
      Contact Us


Hefei KS-V Peptide Biological Technology Co., Ltd.

Products >> MARGATOXIN

MARGATOXIN

Build Your Online Product Catalogs?



Description
Product Name: MARGATOXIN
Supply Ability: 100g
Related proudcts
Specifications see description
Price Term: T/T
Port of loading:
Minimum Order 1mg
Unit Price: 100


SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO. 145808-47-5
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20℃.
Storage of solutions Up to two weeks at 4℃ or three months at -20℃.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide co***ny, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.

Contact Us
Company: Hefei KS-V Peptide Biological Technology Co., Ltd.
Contact: KS-V Peptide .com
Address: The 11th floor£¬New Energy Building£¬Institute of Advanced Technology£¬USTC£¬Hefei, Anhui, China
Postcode: 2018
Tel: 0551-65120828
Fax:
E-mail:         


Copyright© Hefei KS-V Peptide Biological Technology Co., Ltd. All Rights Reserved.
Tel : 0551-65120828 Fax :
Powered by 86exporter.com